• Yeni Kız
Rekombinant İnsan NADH-ubikinon oksidoredüktaz zinciri 5 (MT-ND5) (Rekombinant Protein)

Rekombinant İnsan NADH-ubikinon oksidoredüktaz zinciri 5 (MT-ND5) (Rekombinant Protein)

₺ 181.20

Cins adı : MT-ND5; MTND5; ND5; MTND5, NADH5, ND5; NADH5. Syn Name : Rekombinant NADH-ubikinon oksidoredüktaz zinciri 5 (MT-ND5).NADH-ubikinon oksidoredüktaz zinciri 5 EC = 1.6.5.3; NADH dehidrojenaz alt birimi 5. NADH dehidrojenaz alt birimi 5; NADH-ubikinon oksidoredüktaz zinciri 5. NADH dehidrojenaz, alt birim 5 (kompleks I); mitokondriyal olarak kodlanmış NADH dehidrojenaz 5. Kaynak : E Coli veya Maya.Saflık : > %90 ;* Etiket Bilgisi : Etiketlendi; * Türler : Homo sapiens (İnsan).Depolama Tamponu : PBS p H 7.4, %50 gliserol; * Seq Pos : 1-603. Depolama : -20 derece C'de saklayın. Genişletilmiş depolama için -20 veya -80 derece C'de saklayın.Bu öğe için ÜCRETSİZ-8 GB-USBDrive.Madde araştırma kullanım içindir.Teşhis / tedavi prosedürü için değil. * Form : Bu ürün özel üretim gerektirir ve teslim süresi 5-9 hafta arasındadır.Spesifikasyonlarınıza göre özel üretim yapabiliriz. YP_003024036 ; *Seq : MTMHTTMTTLTLTSLİPPİLTTLVNPNKKNSYPHYVKSİVASTFİİSLFPTTMFMCLDQEVİİSNWHWATTQTTQLSLSFKLDYFSMMFİPVALFVTWSİMEFSLWYMNSDPNİNQFFKYLLİFLİTMLİLVTANNLFQLFİGWEGVGİMSFLLİSWWYARADANTAAİQAİLYNRİGDİGFİLALAWFİLHSNSWDPQQMALLNANPSLTPLLGLLLAAAGKSAQLGLHPWLPSAMEGPTPVSALLHSSTMVVAGİFLLİRFHPLAENSPLİQTLTLCLGAİTTLFAAVCALTQNDİKKİVAFSTSSQLGLMMVTİGİNQPHLAFLHİCTHAFFKAMLFMCSGSİİHNLNNEQDİRKMGGLLKTMPLTSTSLTİGSLALAGMPFLTGFYSKDHİİETANMSYTNAWALSİTLİATSLTSAYSTRMİLLTLTGQPRFPTLTNİNENNPTLLNPİKRLAAGSLFAGFLİTNNİSPASPFQTTİPLYLKLTALAVTFLGLLTALDLNYLTNKLKMKSPLCTFYFSNMLGFYPSİTHRTİPYLGLLTSQNLPLLLLDLTWLEKLLPKTİSQHQİSTSİİTSTQKGMİKLYFLSFFFPLİLTLLLİT; *Katılım* : .1; NC_012920.Kataliz için gerekli asgari Meclisine üye inanılan (Kompleks I) dehidrogenaz mitokondri membran solunum zinciri İNSÜLİN 1; P03915; *Uniprot Özeti : Fonksiyon : Çekirdek birimi.Kompleks I, elektronların nadh'den solunum zincirine transferinde işlev görür.Enzim için hemen elektron alıcısının benzerlikle ubikinon olduğuna inanılmaktadır.Katalitik aktivite : NADH + ubikinon = NAD+ + ubikinol.Hücre altı yeri : Mitokondriyon iç zarı; Benzerliğe göre çok geçişli membran proteini.Hastalığa katılım : MT-nd5'teki defektler Leber kalıtsal optik nöropatinin (LHON) bir nedenidir [MIM : 535000].LHON, optik sinir disfonksiyonuna bağlı olarak akut veya subakut merkezi görme kaybına neden olan maternal olarak kalıtsal bir hastalıktır.Bazı hastalarda kardiyak iletim defektleri ve nörolojik defektler de tanımlanmıştır.LHON, solunum zinciri komplekslerini etkileyen primer mitokondriyal DNA mutasyonlarından kaynaklanır.İlan.13 Hakem.14 Hakem.15 Hakem.21 MT-nd5'teki kusurlar Leigh sendromunun (LS) bir nedenidir [MIM : 256000].LS, subkortikal beyin bölgelerinde bilateral simetrik nekrotik lezyonlarla karakterize ciddi bir nörolojik hastalıktır.İlan.18 Hakem.20 Hakem.23 Kusur.

Ana özellikler

Müşteri seçim